Class b: All beta proteins [48724] (93 folds) |
Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily) |
Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) |
Family b.10.1.2: Plant virus proteins [49616] (15 proteins) |
Protein SBMV coat protein [49631] (1 species) |
Species Southern bean mosaic virus, cow pea strain [TaxId:12139] [49632] (1 PDB entry) |
Domain d4sbvb_: 4sbv B: [23300] |
PDB Entry: 4sbv (more details), 2.8 Å
SCOP Domain Sequences for d4sbvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4sbvb_ b.10.1.2 (B:) SBMV coat protein {Southern bean mosaic virus, cow pea strain} ssmdvtilshcelstelavtvtivvtselvmpftvgtwlrgvaqnwskyawvairytylp scptttsgaihmgfqydmadtlpvsvnqlsnlkgyvtgpvwegqsglcfvnntkcpdtsr aitialdtnevsekrypfktatdyatavgvnanignilvparlvtameggssktavntgr lyasytirliepiaaalnl
Timeline for d4sbvb_: