Lineage for d4sbvb_ (4sbv B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11446Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
  4. 11447Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) (S)
  5. 11461Family b.10.1.2: Plant virus proteins [49616] (15 proteins)
  6. 11491Protein SBMV coat protein [49631] (1 species)
  7. 11492Species Southern bean mosaic virus, cow pea strain [TaxId:12139] [49632] (1 PDB entry)
  8. 11494Domain d4sbvb_: 4sbv B: [23300]

Details for d4sbvb_

PDB Entry: 4sbv (more details), 2.8 Å

PDB Description: the refinement of southern bean mosaic virus in reciprocal space

SCOP Domain Sequences for d4sbvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4sbvb_ b.10.1.2 (B:) SBMV coat protein {Southern bean mosaic virus, cow pea strain}
ssmdvtilshcelstelavtvtivvtselvmpftvgtwlrgvaqnwskyawvairytylp
scptttsgaihmgfqydmadtlpvsvnqlsnlkgyvtgpvwegqsglcfvnntkcpdtsr
aitialdtnevsekrypfktatdyatavgvnanignilvparlvtameggssktavntgr
lyasytirliepiaaalnl

SCOP Domain Coordinates for d4sbvb_:

Click to download the PDB-style file with coordinates for d4sbvb_.
(The format of our PDB-style files is described here.)

Timeline for d4sbvb_: