Class b: All beta proteins [48724] (180 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.7: Tombusviridae-like VP [88643] (5 proteins) |
Protein Sobemovirus coat protein [88644] (4 species) |
Species SBMV (Southern bean mosaic virus), cow pea strain [TaxId:12139] [49632] (1 PDB entry) |
Domain d4sbvb_: 4sbv B: [23300] complexed with ca |
PDB Entry: 4sbv (more details), 2.8 Å
SCOPe Domain Sequences for d4sbvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4sbvb_ b.121.4.7 (B:) Sobemovirus coat protein {SBMV (Southern bean mosaic virus), cow pea strain [TaxId: 12139]} ssmdvtilshcelstelavtvtivvtselvmpftvgtwlrgvaqnwskyawvairytylp scptttsgaihmgfqydmadtlpvsvnqlsnlkgyvtgpvwegqsglcfvnntkcpdtsr aitialdtnevsekrypfktatdyatavgvnanignilvparlvtameggssktavntgr lyasytirliepiaaalnl
Timeline for d4sbvb_: