Lineage for d4sbvb_ (4sbv B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2821778Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2822375Family b.121.4.7: Tombusviridae-like VP [88643] (5 proteins)
  6. 2822386Protein Sobemovirus coat protein [88644] (4 species)
  7. 2822395Species SBMV (Southern bean mosaic virus), cow pea strain [TaxId:12139] [49632] (1 PDB entry)
  8. 2822397Domain d4sbvb_: 4sbv B: [23300]
    complexed with ca

Details for d4sbvb_

PDB Entry: 4sbv (more details), 2.8 Å

PDB Description: the refinement of southern bean mosaic virus in reciprocal space
PDB Compounds: (B:) southern bean mosaic virus coat protein

SCOPe Domain Sequences for d4sbvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4sbvb_ b.121.4.7 (B:) Sobemovirus coat protein {SBMV (Southern bean mosaic virus), cow pea strain [TaxId: 12139]}
ssmdvtilshcelstelavtvtivvtselvmpftvgtwlrgvaqnwskyawvairytylp
scptttsgaihmgfqydmadtlpvsvnqlsnlkgyvtgpvwegqsglcfvnntkcpdtsr
aitialdtnevsekrypfktatdyatavgvnanignilvparlvtameggssktavntgr
lyasytirliepiaaalnl

SCOPe Domain Coordinates for d4sbvb_:

Click to download the PDB-style file with coordinates for d4sbvb_.
(The format of our PDB-style files is described here.)

Timeline for d4sbvb_: