| Class b: All beta proteins [48724] (126 folds) |
| Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.5: ssDNA viruses [88645] (3 families) ![]() |
| Family b.121.5.1: Microviridae-like VP [49612] (1 protein) |
| Protein Microvirus capsid proteins [49613] (3 species) |
| Species Bacteriophage phi-X174 [TaxId:10847] [49614] (4 PDB entries) |
| Domain d1cd3g_: 1cd3 G: [23277] Other proteins in same PDB: d1cd31_, d1cd32_, d1cd33_, d1cd34_ |
PDB Entry: 1cd3 (more details), 3.5 Å
SCOP Domain Sequences for d1cd3g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cd3g_ b.121.5.1 (G:) Microvirus capsid proteins {Bacteriophage phi-X174}
mfqtfisrhnsnffsdklvltsvtpassapvlqtpkatsstlyfdsltvnagnggflhci
qmdtsvnaanqvvsvgadiafdadpkffaclvrfesssvpttlptaydvyplngrhdggy
ytvkdcvtidvlprtpgnnvyvgfmvwsnftatkcrglvslnqvikeiiclqplk
Timeline for d1cd3g_: