SCOP 1.65: Domain d1cd3f_: 1cd3 F:

Lineage for d1cd3f_ (1cd3 F:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.5: ssDNA viruses [88645] (3 families)

5. Family b.121.5.1: Microviridae-like VP [49612] (1 protein)

6. Protein Microvirus capsid proteins [49613] (3 species)

7. Species Bacteriophage phi-X174 [TaxId:10847] [49614] (4 PDB entries)

8. Domain d1cd3f_: 1cd3 F: [23276]
   Other proteins in same PDB: d1cd31_, d1cd32_, d1cd33_, d1cd34_

Details for d1cd3f_

PDB Entry: 1cd3, 3.5 Å

PDB Description: procapsid of bacteriophage phix174

SCOP Domain Sequences for d1cd3f_:

Sequence; same for both SEQRES and ATOM records:

>d1cd3f_ b.121.5.1 (F:) Microvirus capsid proteins {Bacteriophage phi-X174}
sniqtgaermphdlshlgflagqigrlitisttpviagdsfemdavgalrlsplrrglai
dstvdiftfyvphrhvygeqwikfmkdgvnatplptvnttgyidhaaflgtinpdtnkip
khlfqgylniynnyfkapwmpdrteanpnelnqddarfgfrcchlkniwtaplppetels
rqmttsttsidimglqaayanlhtdqerdyfmqryrdvissfggktsydadnrpllvmrs
nlwasgydvdgtdqtslgqfsgrvqqtykhsvprffvpehgtmftlalvrfpptatkeiq
ylnakgaltytdiagdpvlygnlppreismkdvfrsgdsskkfkiaegqwyryapsyvsp
ayhllegfpfiqeppsgdlqervlirhhdydqcfqsvqllqwnsqvkfnvtvyrnlpttr
dsimts

Timeline for d1cd3f_:

• d1cd3f_ first appeared (with stable ids) in SCOP 1.55
  
• d1cd3f_ appears in SCOP 1.63
  
• d1cd3f_ appears in SCOP 1.67
  
• d1cd3f_ appears in the current release, SCOPe 2.08