Lineage for d1cd3g_ (1cd3 G:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2823004Superfamily b.121.5: ssDNA viruses [88645] (4 families) (S)
  5. 2823005Family b.121.5.1: Microviridae-like VP [49612] (2 proteins)
  6. Protein Microvirus capsid proteins, spike protein G [418933] (3 species)
    protein includes capsid protein F and spike protein G
  7. Species Bacteriophage phi-X174 [TaxId:10847] [419371] (3 PDB entries)
  8. 2823025Domain d1cd3g_: 1cd3 G: [23277]
    Other proteins in same PDB: d1cd31_, d1cd32_, d1cd33_, d1cd34_, d1cd3f_

Details for d1cd3g_

PDB Entry: 1cd3 (more details), 3.5 Å

PDB Description: procapsid of bacteriophage phix174
PDB Compounds: (G:) protein (spike protein gpg)

SCOPe Domain Sequences for d1cd3g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cd3g_ b.121.5.1 (G:) Microvirus capsid proteins, spike protein G {Bacteriophage phi-X174 [TaxId: 10847]}
mfqtfisrhnsnffsdklvltsvtpassapvlqtpkatsstlyfdsltvnagnggflhci
qmdtsvnaanqvvsvgadiafdadpkffaclvrfesssvpttlptaydvyplngrhdggy
ytvkdcvtidvlprtpgnnvyvgfmvwsnftatkcrglvslnqvikeiiclqplk

SCOPe Domain Coordinates for d1cd3g_:

Click to download the PDB-style file with coordinates for d1cd3g_.
(The format of our PDB-style files is described here.)

Timeline for d1cd3g_: