![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
![]() | Superfamily b.121.5: ssDNA viruses [88645] (4 families) ![]() |
![]() | Family b.121.5.1: Microviridae-like VP [49612] (2 proteins) |
![]() | Domain d1cd3g_: 1cd3 G: [23277] Other proteins in same PDB: d1cd31_, d1cd32_, d1cd33_, d1cd34_, d1cd3f_ |
PDB Entry: 1cd3 (more details), 3.5 Å
SCOPe Domain Sequences for d1cd3g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cd3g_ b.121.5.1 (G:) Microvirus capsid proteins, spike protein G {Bacteriophage phi-X174 [TaxId: 10847]} mfqtfisrhnsnffsdklvltsvtpassapvlqtpkatsstlyfdsltvnagnggflhci qmdtsvnaanqvvsvgadiafdadpkffaclvrfesssvpttlptaydvyplngrhdggy ytvkdcvtidvlprtpgnnvyvgfmvwsnftatkcrglvslnqvikeiiclqplk
Timeline for d1cd3g_: