Lineage for d1cd3g_ (1cd3 G:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 225197Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
    sandwich; 8 strands in 2 sheets; jelly-roll
    variations: some members have additional 1-2 strands
  4. 225198Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) (S)
  5. 225199Family b.10.1.1: Bacteriophage capsid proteins [49612] (1 protein)
  6. 225200Protein Bacteriophage capsid proteins [49613] (3 species)
  7. 225207Species Bacteriophage phi-X174 [TaxId:10847] [49614] (4 PDB entries)
  8. 225213Domain d1cd3g_: 1cd3 G: [23277]
    Other proteins in same PDB: d1cd31_, d1cd32_, d1cd33_, d1cd34_

Details for d1cd3g_

PDB Entry: 1cd3 (more details), 3.5 Å

PDB Description: procapsid of bacteriophage phix174

SCOP Domain Sequences for d1cd3g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cd3g_ b.10.1.1 (G:) Bacteriophage capsid proteins {Bacteriophage phi-X174}
mfqtfisrhnsnffsdklvltsvtpassapvlqtpkatsstlyfdsltvnagnggflhci
qmdtsvnaanqvvsvgadiafdadpkffaclvrfesssvpttlptaydvyplngrhdggy
ytvkdcvtidvlprtpgnnvyvgfmvwsnftatkcrglvslnqvikeiiclqplk

SCOP Domain Coordinates for d1cd3g_:

Click to download the PDB-style file with coordinates for d1cd3g_.
(The format of our PDB-style files is described here.)

Timeline for d1cd3g_: