SCOP 1.63: Domain d1cd3g_: 1cd3 G:

Lineage for d1cd3g_ (1cd3 G:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
   sandwich; 8 strands in 2 sheets; jelly-roll
   variations: some members have additional 1-2 strands

4. Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families)

5. Family b.10.1.1: Bacteriophage capsid proteins [49612] (1 protein)

6. Protein Bacteriophage capsid proteins [49613] (3 species)

7. Species Bacteriophage phi-X174 [TaxId:10847] [49614] (4 PDB entries)

8. Domain d1cd3g_: 1cd3 G: [23277]
   Other proteins in same PDB: d1cd31_, d1cd32_, d1cd33_, d1cd34_

Details for d1cd3g_

PDB Entry: 1cd3, 3.5 Å

PDB Description: procapsid of bacteriophage phix174

SCOP Domain Sequences for d1cd3g_:

Sequence; same for both SEQRES and ATOM records:

>d1cd3g_ b.10.1.1 (G:) Bacteriophage capsid proteins {Bacteriophage phi-X174}
mfqtfisrhnsnffsdklvltsvtpassapvlqtpkatsstlyfdsltvnagnggflhci
qmdtsvnaanqvvsvgadiafdadpkffaclvrfesssvpttlptaydvyplngrhdggy
ytvkdcvtidvlprtpgnnvyvgfmvwsnftatkcrglvslnqvikeiiclqplk

Timeline for d1cd3g_:

• d1cd3g_ first appeared (with stable ids) in SCOP 1.55
  
• d1cd3g_ appears in SCOP 1.61
  
• d1cd3g_ appears in SCOP 1.65
  
• d1cd3g_ appears in the current release, SCOPe 2.08