![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily) |
![]() | Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) ![]() |
![]() | Family b.10.1.1: Bacteriophage capsid proteins [49612] (1 protein) |
![]() | Protein Bacteriophage capsid proteins [49613] (2 species) |
![]() | Species Bacteriophage phi-X174 [TaxId:10847] [49614] (4 PDB entries) |
![]() | Domain d1cd3g_: 1cd3 G: [23277] Other proteins in same PDB: d1cd31_, d1cd32_, d1cd33_, d1cd34_ |
PDB Entry: 1cd3 (more details), 3.5 Å
SCOP Domain Sequences for d1cd3g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cd3g_ b.10.1.1 (G:) Bacteriophage capsid proteins {Bacteriophage phi-X174} mfqtfisrhnsnffsdklvltsvtpassapvlqtpkatsstlyfdsltvnagnggflhci qmdtsvnaanqvvsvgadiafdadpkffaclvrfesssvpttlptaydvyplngrhdggy ytvkdcvtidvlprtpgnnvyvgfmvwsnftatkcrglvslnqvikeiiclqplk
Timeline for d1cd3g_: