Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) |
Family c.1.18.0: automated matches [191539] (1 protein) not a true family |
Protein automated matches [190919] (11 species) not a true protein |
Species Silicibacter pomeroyi [TaxId:89184] [232751] (1 PDB entry) |
Domain d3l12a_: 3l12 A: [232752] automated match to d3ch0a_ complexed with cl, mg, unl |
PDB Entry: 3l12 (more details), 1.6 Å
SCOPe Domain Sequences for d3l12a_:
Sequence, based on SEQRES records: (download)
>d3l12a_ c.1.18.0 (A:) automated matches {Silicibacter pomeroyi [TaxId: 89184]} gfsqleglrghpsvvrvighrgargvmpentlegfaftlaagvralefdvvmtadgvpvv thnhhlanamtrdgqghwltgaerqvaemtyaeiraldvggldgrtvygrrfpdqafltg ihvprlgelldlcagygdqapylllelksdpalmhdhaaraemvaavladvrryrmeprt vmhsfdwallgecrrqapdlptsylsqlpenaddpgedsakpvgpdydrmteslpqavas aggqlwcpyfldvtpelvaeahdlglivltwtvnepedirrmattgvdgivtdypgrtqr ilidmglswt
>d3l12a_ c.1.18.0 (A:) automated matches {Silicibacter pomeroyi [TaxId: 89184]} gfsqleglrghpsvvrvighrgargvmpentlegfaftlaagvralefdvvmtadgvpvv thnhhlanamtrdgqghwltgaerqvaemtyaeiraldvggldgrtvygrrfpdqafltg ihvprlgelldlcagygdqapylllelksdpalmhdhaaraemvaavladvrryrmeprt vmhsfdwallgecrrqapdlptsylsqlpegpdydrmteslpqavasaggqlwcpyfldv tpelvaeahdlglivltwtvnepedirrmattgvdgivtdypgrtqrilidmglswt
Timeline for d3l12a_: