Lineage for d3l12a_ (3l12 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089342Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) (S)
  5. 2089425Family c.1.18.0: automated matches [191539] (1 protein)
    not a true family
  6. 2089426Protein automated matches [190919] (11 species)
    not a true protein
  7. 2089450Species Silicibacter pomeroyi [TaxId:89184] [232751] (1 PDB entry)
  8. 2089451Domain d3l12a_: 3l12 A: [232752]
    automated match to d3ch0a_
    complexed with cl, mg, unl

Details for d3l12a_

PDB Entry: 3l12 (more details), 1.6 Å

PDB Description: crystal structure of putative glycerophosphoryl diester phosphodiesterase (yp_165505.1) from silicibacter pomeroyi dss-3 at 1.60 a resolution
PDB Compounds: (A:) putative glycerophosphoryl diester phosphodiesterase

SCOPe Domain Sequences for d3l12a_:

Sequence, based on SEQRES records: (download)

>d3l12a_ c.1.18.0 (A:) automated matches {Silicibacter pomeroyi [TaxId: 89184]}
gfsqleglrghpsvvrvighrgargvmpentlegfaftlaagvralefdvvmtadgvpvv
thnhhlanamtrdgqghwltgaerqvaemtyaeiraldvggldgrtvygrrfpdqafltg
ihvprlgelldlcagygdqapylllelksdpalmhdhaaraemvaavladvrryrmeprt
vmhsfdwallgecrrqapdlptsylsqlpenaddpgedsakpvgpdydrmteslpqavas
aggqlwcpyfldvtpelvaeahdlglivltwtvnepedirrmattgvdgivtdypgrtqr
ilidmglswt

Sequence, based on observed residues (ATOM records): (download)

>d3l12a_ c.1.18.0 (A:) automated matches {Silicibacter pomeroyi [TaxId: 89184]}
gfsqleglrghpsvvrvighrgargvmpentlegfaftlaagvralefdvvmtadgvpvv
thnhhlanamtrdgqghwltgaerqvaemtyaeiraldvggldgrtvygrrfpdqafltg
ihvprlgelldlcagygdqapylllelksdpalmhdhaaraemvaavladvrryrmeprt
vmhsfdwallgecrrqapdlptsylsqlpegpdydrmteslpqavasaggqlwcpyfldv
tpelvaeahdlglivltwtvnepedirrmattgvdgivtdypgrtqrilidmglswt

SCOPe Domain Coordinates for d3l12a_:

Click to download the PDB-style file with coordinates for d3l12a_.
(The format of our PDB-style files is described here.)

Timeline for d3l12a_: