SCOPe 2.07: Domain d3hy2b_: 3hy2 B:

Lineage for d3hy2b_ (3hy2 B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein automated matches [190100] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187259] (20 PDB entries)

8. Domain d3hy2b_: 3hy2 B: [232520]
   Other proteins in same PDB: d3hy2x_, d3hy2y_
   automated match to d1qmva_
   complexed with atp, mg

Details for d3hy2b_

PDB Entry: 3hy2, 2.1 Å

PDB Description: crystal structure of sulfiredoxin in complex with peroxiredoxin i and atp:mg2+

PDB Compounds: (B:) Peroxiredoxin-1

SCOPe Domain Sequences for d3hy2b_:

Sequence; same for both SEQRES and ATOM records:

>d3hy2b_ c.47.1.10 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sgnakighpapnfkatavmpdgqfkdislsdykgkyvvfffypldftfvdpteiiafsdr
aeefkklnsqvigasvdshfehlewvntpkkqgglgpmniplvsdpkrtiaqdygvlkad
egisfrglfiiddkgilrqitvndlpvgrsvdetlrlvqafqftdkhgevspagwkpgsd
ticp

Timeline for d3hy2b_:

• d3hy2b_ first appeared in SCOPe 2.03
  
• d3hy2b_ appears in SCOPe 2.06
  
• d3hy2b_ appears in the current release, SCOPe 2.08