Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
Protein automated matches [190100] (20 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187259] (20 PDB entries) |
Domain d3hy2a_: 3hy2 A: [232521] Other proteins in same PDB: d3hy2x_, d3hy2y_ automated match to d1qmva_ complexed with atp, mg |
PDB Entry: 3hy2 (more details), 2.1 Å
SCOPe Domain Sequences for d3hy2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hy2a_ c.47.1.10 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} sgnakighpapnfkatavmpdgqfkdislsdykgkyvvfffypldftfvdpteiiafsdr aeefkklnsqvigasvdshfehlewvntpkkqgglgpmniplvsdpkrtiaqdygvlkad egisfrglfiiddkgilrqitvndlpvgrsvdetlrlvqafqftdkhgevspagwkpgsd ticpd
Timeline for d3hy2a_: