Lineage for d3hy2b_ (3hy2 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2132842Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2133248Protein automated matches [190100] (19 species)
    not a true protein
  7. 2133430Species Human (Homo sapiens) [TaxId:9606] [187259] (19 PDB entries)
  8. 2133454Domain d3hy2b_: 3hy2 B: [232520]
    Other proteins in same PDB: d3hy2x_, d3hy2y_
    automated match to d1qmva_
    complexed with atp, mg

Details for d3hy2b_

PDB Entry: 3hy2 (more details), 2.1 Å

PDB Description: crystal structure of sulfiredoxin in complex with peroxiredoxin i and atp:mg2+
PDB Compounds: (B:) Peroxiredoxin-1

SCOPe Domain Sequences for d3hy2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hy2b_ c.47.1.10 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sgnakighpapnfkatavmpdgqfkdislsdykgkyvvfffypldftfvdpteiiafsdr
aeefkklnsqvigasvdshfehlewvntpkkqgglgpmniplvsdpkrtiaqdygvlkad
egisfrglfiiddkgilrqitvndlpvgrsvdetlrlvqafqftdkhgevspagwkpgsd
ticp

SCOPe Domain Coordinates for d3hy2b_:

Click to download the PDB-style file with coordinates for d3hy2b_.
(The format of our PDB-style files is described here.)

Timeline for d3hy2b_: