SCOPe 2.08: Domain d3hg0d1: 3hg0 D:13-135

Lineage for d3hg0d1 (3hg0 D:13-135)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families)
   repeats organized in elongated structures

5. Family d.211.1.1: Ankyrin repeat [48404] (21 proteins)
   this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain

6. Protein automated matches [190101] (7 species)
   not a true protein

7. Species Artificial gene [TaxId:32630] [193962] (5 PDB entries)

8. Domain d3hg0d1: 3hg0 D:13-135 [232467]
   Other proteins in same PDB: d3hg0a1, d3hg0a2, d3hg0b1, d3hg0c1, d3hg0c2, d3hg0d2
   automated match to d1awcb_
   applies to all domains of a family if the common domain is composed of a different number of small repeating units

Details for d3hg0d1

PDB Entry: 3hg0, 2.1 Å

PDB Description: Crystal structure of a DARPin in complex with ORF49 from Lactococcal phage TP901-1

PDB Compounds: (D:) Designed Ankyrin Repeat Protein (DARPin) 20

SCOPe Domain Sequences for d3hg0d1:

Sequence; same for both SEQRES and ATOM records:

>d3hg0d1 d.211.1.1 (D:13-135) automated matches {Artificial gene [TaxId: 32630]}
dlgkklleaaragqddevrilmangadvnaedkvgltplhlaamndhleivevllkngad
vnaidaigetplhlvamyghleivevllkhgadvnaqdkfgktafdisidngnedlaeil
qkl

Timeline for d3hg0d1:

• d3hg0d1 first appeared in SCOPe 2.03, called d3hg0d_
  
• d3hg0d1 appears in SCOPe 2.07