![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily) sandwich, 10 strands in 2 sheets; greek-key |
![]() | Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) ![]() |
![]() | Family b.21.1.3: Lactophage receptor-binding protein head domain [141122] (3 proteins) automatically mapped to Pfam PF08932 |
![]() | Protein automated matches [232461] (1 species) not a true protein |
![]() | Species Lactococcus phage [TaxId:35345] [232462] (6 PDB entries) |
![]() | Domain d3hg0a1: 3hg0 A:63-163 [232466] Other proteins in same PDB: d3hg0a2, d3hg0c1, d3hg0d1, d3hg0d2 automated match to d2f0ca1 |
PDB Entry: 3hg0 (more details), 2.1 Å
SCOPe Domain Sequences for d3hg0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hg0a1 b.21.1.3 (A:63-163) automated matches {Lactococcus phage [TaxId: 35345]} ptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcslv ghmvggwnafhidipssgvcqwfgptassgtprgtgtypid
Timeline for d3hg0a1: