Lineage for d1awcb_ (1awc B:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
multiple repeats of beta(2)-alpha(2) motifSuperfamily d.211.1: Ankyrin repeat [48403] (2 families) 
repeats organized in elongated structuresFamily d.211.1.1: Ankyrin repeat [48404] (21 proteins)
this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain
Protein GA bindinig protein (GABP) beta 1 [48407] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [48408] (1 PDB entry) 
Domain d1awcb_: 1awc B: [19156]
Other proteins in same PDB: d1awca_
protein/DNA complex
applies to all domains of a family if the common domain is composed of a different number of small repeating units
Details for d1awcb_
PDB Entry: 1awc (more details), 2.15 Å
PDB Description: mouse gabp alpha/beta domain bound to dna
PDB Compounds: (B:) protein (ga binding protein beta 1)SCOPe Domain Sequences for d1awcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]}
dlgkklleaaragqddevrilmangapfttdwlgtsplhlaaqyghfsttevllragvsr
dartkvdrtplhmaaseghanivevllkhgadvnakdmlkmtalhwatehnhqevvelli
kygadvhtqskfcktafdisidngnedlaeilq
SCOPe Domain Coordinates for d1awcb_:
Click to download the PDB-style file with coordinates for d1awcb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1awcb_:
- d1awcb_ first appeared (with stable ids) in SCOP 1.55
- d1awcb_ appears in SCOPe 2.07
View in 3D
