SCOPe 2.08: Domain d1awca_: 1awc A:

Lineage for d1awca_ (1awc A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.21: ets domain [46859] (9 proteins)

6. Protein GA binding protein (GABP) alpha [46867] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [46868] (1 PDB entry)

8. Domain d1awca_: 1awc A: [16167]
   Other proteins in same PDB: d1awcb_
   protein/DNA complex
   has additional insertions and/or extensions that are not grouped together

Details for d1awca_

PDB Entry: 1awc, 2.15 Å

PDB Description: mouse gabp alpha/beta domain bound to dna

PDB Compounds: (A:) protein (ga binding protein alpha)

SCOPe Domain Sequences for d1awca_:

Sequence; same for both SEQRES and ATOM records:

>d1awca_ a.4.5.21 (A:) GA binding protein (GABP) alpha {Mouse (Mus musculus) [TaxId: 10090]}
iqlwqfllelltdkdardciswvgdegefklnqpelvaqkwgqrknkptmnyeklsralr
yyydgdmickvqgkrfvykfvcdlktligysaaelnrlvieceqkklarm

Timeline for d1awca_:

• d1awca_ first appeared (with stable ids) in SCOP 1.55
  
• d1awca_ appears in SCOPe 2.07