SCOPe 2.08: Domain d2x1ma2: 2x1m A:354-512

Lineage for d2x1ma2 (2x1m A:354-512)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
   core: 4 helices; bundle; one loop crosses over one side of the bundle

4. Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families)

5. Family a.27.1.0: automated matches [227164] (1 protein)
   not a true family

6. Protein automated matches [226872] (13 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:246196] [231531] (2 PDB entries)

8. Domain d2x1ma2: 2x1m A:354-512 [231536]
   Other proteins in same PDB: d2x1ma1
   automated match to d4eg3b2
   protein/RNA complex; complexed with 2hp, cxs, met

Details for d2x1ma2

PDB Entry: 2x1m, 2.8 Å

PDB Description: crystal structure of mycobacterium smegmatis methionyl-trna synthetase in complex with methionine

PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d2x1ma2:

Sequence; same for both SEQRES and ATOM records:

>d2x1ma2 a.27.1.0 (A:354-512) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
anelgnlaqrslsmvaknlgaavpdpgeftdedtallaaadallervrehfdvpamhlal
eaiwsvlgaanryfsaqepwvlrksdaaedqqrfrtvlyttlevvriaslllqpvmpest
aklldllgqptderdfsaianrikpgtslpapsgifpry

Timeline for d2x1ma2:

• d2x1ma2 first appeared in SCOPe 2.03
  
• d2x1ma2 appears in SCOPe 2.07