SCOPe 2.08: Domain d2x1ma1: 2x1m A:2-135,A:136-353

Lineage for d2x1ma1 (2x1m A:2-135,A:136-353)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (61 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:246196] [231529] (2 PDB entries)

8. Domain d2x1ma1: 2x1m A:2-135,A:136-353 [231535]
   Other proteins in same PDB: d2x1ma2
   automated match to d4eg3b1
   protein/RNA complex; complexed with 2hp, cxs, met

Details for d2x1ma1

PDB Entry: 2x1m, 2.8 Å

PDB Description: crystal structure of mycobacterium smegmatis methionyl-trna synthetase in complex with methionine

PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d2x1ma1:

Sequence; same for both SEQRES and ATOM records:

>d2x1ma1 c.26.1.0 (A:2-135,A:136-353) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
sepfyittaiaypngvphighayeyiatdaiarfkrldgydvryltgtdvhgqkmaetaa
kegipaaelarrnsdvfqrlqeklnisfdrfirtsdadhyeaskaiwkrmadagdiylda
ykgwysirderfftXenetteqpdgtriatetgapvtwteeqtyffrlsaytdrllalye
ehpefigpdarrneivsfvsgglkdlsisrttfdwgvpvpdhpdhvmyvwvdaltnyltg
vgfpdtesesfrrywpadlhmigkdiirfhtvywpaflmsaglplpkrifahgwllnrge
kmsksignvvdpvnlvdtfgldqvryfllrevpfgqdgsynedaiigrvnadl

Timeline for d2x1ma1:

• d2x1ma1 first appeared in SCOPe 2.03
  
• d2x1ma1 appears in SCOPe 2.07