Lineage for d2x1ma2 (2x1m A:354-512)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319167Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 2319168Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) (S)
  5. 2319221Family a.27.1.0: automated matches [227164] (1 protein)
    not a true family
  6. 2319222Protein automated matches [226872] (13 species)
    not a true protein
  7. 2319247Species Mycobacterium smegmatis [TaxId:246196] [231531] (2 PDB entries)
  8. 2319251Domain d2x1ma2: 2x1m A:354-512 [231536]
    Other proteins in same PDB: d2x1ma1
    automated match to d4eg3b2
    protein/RNA complex; complexed with 2hp, cxs, met

Details for d2x1ma2

PDB Entry: 2x1m (more details), 2.8 Å

PDB Description: crystal structure of mycobacterium smegmatis methionyl-trna synthetase in complex with methionine
PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d2x1ma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x1ma2 a.27.1.0 (A:354-512) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
anelgnlaqrslsmvaknlgaavpdpgeftdedtallaaadallervrehfdvpamhlal
eaiwsvlgaanryfsaqepwvlrksdaaedqqrfrtvlyttlevvriaslllqpvmpest
aklldllgqptderdfsaianrikpgtslpapsgifpry

SCOPe Domain Coordinates for d2x1ma2:

Click to download the PDB-style file with coordinates for d2x1ma2.
(The format of our PDB-style files is described here.)

Timeline for d2x1ma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2x1ma1