![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily) core: 4 helices; bundle; one loop crosses over one side of the bundle |
![]() | Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) ![]() |
![]() | Family a.27.1.0: automated matches [227164] (1 protein) not a true family |
![]() | Protein automated matches [226872] (6 species) not a true protein |
![]() | Species Mycobacterium smegmatis [TaxId:246196] [231531] (2 PDB entries) |
![]() | Domain d2x1ma2: 2x1m A:354-512 [231536] Other proteins in same PDB: d2x1ma1 automated match to d4eg3b2 protein/RNA complex; complexed with 2hp, cxs, met |
PDB Entry: 2x1m (more details), 2.8 Å
SCOPe Domain Sequences for d2x1ma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x1ma2 a.27.1.0 (A:354-512) automated matches {Mycobacterium smegmatis [TaxId: 246196]} anelgnlaqrslsmvaknlgaavpdpgeftdedtallaaadallervrehfdvpamhlal eaiwsvlgaanryfsaqepwvlrksdaaedqqrfrtvlyttlevvriaslllqpvmpest aklldllgqptderdfsaianrikpgtslpapsgifpry
Timeline for d2x1ma2: