Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
Superfamily d.37.1: CBS-domain pair [54631] (2 families) |
Family d.37.1.1: CBS-domain pair [54632] (21 proteins) Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain |
Protein automated matches [190627] (7 species) not a true protein |
Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [231218] (4 PDB entries) |
Domain d2qr1g1: 2qr1 G:3-181 [231220] Other proteins in same PDB: d2qr1a_, d2qr1b_, d2qr1c_, d2qr1d_, d2qr1g3 automated match to d2ooxe1 complexed with adp |
PDB Entry: 2qr1 (more details), 2.7 Å
SCOPe Domain Sequences for d2qr1g1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qr1g1 d.37.1.1 (G:3-181) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} dvqetqkgalkeiqafirsrtsydvlptsfrlivfdvtlfvktslslltlnnivsaplwd seankfaglltmadfvnvikyyyqsssfpeaiaeidkfrllglreverkigaippetiyv hpmhslmdaclamsksrarriplidvdgetgsemivsvltqyrilkfismncketamlr
Timeline for d2qr1g1: