Lineage for d2qr1g2 (2qr1 G:182-334)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187447Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 2187448Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 2187449Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
    Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain
  6. 2187587Protein automated matches [190627] (7 species)
    not a true protein
  7. 2187588Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [231218] (4 PDB entries)
  8. 2187596Domain d2qr1g2: 2qr1 G:182-334 [231225]
    Other proteins in same PDB: d2qr1a_, d2qr1b_, d2qr1c_, d2qr1d_, d2qr1g3
    automated match to d2ooxe2
    complexed with adp

Details for d2qr1g2

PDB Entry: 2qr1 (more details), 2.7 Å

PDB Description: Crystal structure of the adenylate sensor from AMP-activated protein kinase in complex with ADP
PDB Compounds: (G:) Protein C1556.08c

SCOPe Domain Sequences for d2qr1g2:

Sequence, based on SEQRES records: (download)

>d2qr1g2 d.37.1.1 (G:182-334) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
vplnqmtigtwsnlatasmetkvydvikmlaeknisavpivnsegtllnvyesvdvmhli
qdgdysnldlsvgeallkrpanfdgvhtcratdrldgifdaikhsrvhrlfvvdenlkle
gilsladilnyiiydktttpgvpeqtdnfesav

Sequence, based on observed residues (ATOM records): (download)

>d2qr1g2 d.37.1.1 (G:182-334) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
vplnqmtigtwsnlatasmetkvydvikmlaeknisavpivnsegtllnvyesvdvmhli
qdgdysnldlsvgeallkrpanfdgvhtcratdrldgifdaikhsrvhrlfvvdenlkle
gilsladilnyiiydkdnfesav

SCOPe Domain Coordinates for d2qr1g2:

Click to download the PDB-style file with coordinates for d2qr1g2.
(The format of our PDB-style files is described here.)

Timeline for d2qr1g2: