Lineage for d2qr1g1 (2qr1 G:1-181)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1409742Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 1409743Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 1409744Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
    Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain
  6. 1409866Protein automated matches [190627] (7 species)
    not a true protein
  7. 1409883Species Schizosaccharomyces pombe [TaxId:4896] [231218] (3 PDB entries)
  8. 1409890Domain d2qr1g1: 2qr1 G:1-181 [231220]
    Other proteins in same PDB: d2qr1a_, d2qr1b_, d2qr1c_, d2qr1d_
    automated match to d2ooxe1
    complexed with adp

Details for d2qr1g1

PDB Entry: 2qr1 (more details), 2.7 Å

PDB Description: Crystal structure of the adenylate sensor from AMP-activated protein kinase in complex with ADP
PDB Compounds: (G:) Protein C1556.08c

SCOPe Domain Sequences for d2qr1g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qr1g1 d.37.1.1 (G:1-181) automated matches {Schizosaccharomyces pombe [TaxId: 4896]}
amdvqetqkgalkeiqafirsrtsydvlptsfrlivfdvtlfvktslslltlnnivsapl
wdseankfaglltmadfvnvikyyyqsssfpeaiaeidkfrllglreverkigaippeti
yvhpmhslmdaclamsksrarriplidvdgetgsemivsvltqyrilkfismncketaml
r

SCOPe Domain Coordinates for d2qr1g1:

Click to download the PDB-style file with coordinates for d2qr1g1.
(The format of our PDB-style files is described here.)

Timeline for d2qr1g1: