Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.353: AMPKBI-like [160218] (1 superfamily) comprises 3 short helices and 3-stranded meander beta-sheet; makes extensive intermolecular interactions |
Superfamily d.353.1: AMPKBI-like [160219] (1 family) automatically mapped to Pfam PF04739 |
Family d.353.1.1: AMPKBI-like [160220] (4 proteins) Pfam PF04739; 5'-AMP-activated protein kinase, beta subunit, complex-interacting region |
Protein automated matches [190789] (2 species) not a true protein |
Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [188232] (4 PDB entries) |
Domain d2qr1b_: 2qr1 B: [151275] Other proteins in same PDB: d2qr1a_, d2qr1c_, d2qr1e1, d2qr1e2, d2qr1g1, d2qr1g2, d2qr1g3 automated match to d2ooxb1 complexed with adp |
PDB Entry: 2qr1 (more details), 2.7 Å
SCOPe Domain Sequences for d2qr1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qr1b_ d.353.1.1 (B:) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} qysteipafltsntlqelklpkppslpphlekcilnsntaykedqsvlpnpnhvllnhla aantqlgvlalsattryhrkyvttamfknfd
Timeline for d2qr1b_: