Lineage for d1joi__ (1joi -)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 224388Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 224389Superfamily b.6.1: Cupredoxins [49503] (5 families) (S)
    contains copper-binding site
  5. 224390Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)
    mono-domain proteins
  6. 224416Protein Azurin [49530] (6 species)
  7. 224561Species Pseudomonas fluorescens [TaxId:294] [49534] (1 PDB entry)
  8. 224562Domain d1joi__: 1joi - [23010]
    complexed with cu

Details for d1joi__

PDB Entry: 1joi (more details), 2.05 Å

PDB Description: structure of pseudomonas fluorescens holo azurin

SCOP Domain Sequences for d1joi__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1joi__ b.6.1.1 (-) Azurin {Pseudomonas fluorescens}
aeckvtvdstdqmsfntkaieidkscktftvelthsgslpknvmghnwvlssaadmpgia
sdgmaagidknylkegdtrviahtkiigagekdsvtfdvsklaagtdyaffcsfpghism
mkgtvtvk

SCOP Domain Coordinates for d1joi__:

Click to download the PDB-style file with coordinates for d1joi__.
(The format of our PDB-style files is described here.)

Timeline for d1joi__: