SCOPe 2.08: Domain d1joia_: 1joi A:

Lineage for d1joia_ (1joi A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Azurin [49530] (6 species)

7. Species Pseudomonas fluorescens [TaxId:294] [49534] (1 PDB entry)

8. Domain d1joia_: 1joi A: [23010]
   complexed with cu

Details for d1joia_

PDB Entry: 1joi, 2.05 Å

PDB Description: structure of pseudomonas fluorescens holo azurin

PDB Compounds: (A:) Azurin

SCOPe Domain Sequences for d1joia_:

Sequence; same for both SEQRES and ATOM records:

>d1joia_ b.6.1.1 (A:) Azurin {Pseudomonas fluorescens [TaxId: 294]}
aeckvtvdstdqmsfntkaieidkscktftvelthsgslpknvmghnwvlssaadmpgia
sdgmaagidknylkegdtrviahtkiigagekdsvtfdvsklaagtdyaffcsfpghism
mkgtvtvk

Timeline for d1joia_:

• d1joia_ first appeared (with stable ids) in SCOP 1.55, called d1joi__
  
• d1joia_ appears in SCOPe 2.07