![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
![]() | Protein Azurin [49530] (6 species) |
![]() | Species Pseudomonas fluorescens [TaxId:294] [49534] (1 PDB entry) |
![]() | Domain d1joia_: 1joi A: [23010] complexed with cu |
PDB Entry: 1joi (more details), 2.05 Å
SCOPe Domain Sequences for d1joia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1joia_ b.6.1.1 (A:) Azurin {Pseudomonas fluorescens [TaxId: 294]} aeckvtvdstdqmsfntkaieidkscktftvelthsgslpknvmghnwvlssaadmpgia sdgmaagidknylkegdtrviahtkiigagekdsvtfdvsklaagtdyaffcsfpghism mkgtvtvk
Timeline for d1joia_: