Lineage for d1joi__ (1joi -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10904Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 10905Superfamily b.6.1: Cupredoxins [49503] (3 families) (S)
  5. 10906Family b.6.1.1: Plastocyanin/azurin-like [49504] (7 proteins)
  6. 10917Protein Azurin [49530] (6 species)
  7. 11034Species Pseudomonas fluorescens [TaxId:294] [49534] (1 PDB entry)
  8. 11035Domain d1joi__: 1joi - [23010]

Details for d1joi__

PDB Entry: 1joi (more details), 2.05 Å

PDB Description: structure of pseudomonas fluorescens holo azurin

SCOP Domain Sequences for d1joi__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1joi__ b.6.1.1 (-) Azurin {Pseudomonas fluorescens}
aeckvtvdstdqmsfntkaieidkscktftvelthsgslpknvmghnwvlssaadmpgia
sdgmaagidknylkegdtrviahtkiigagekdsvtfdvsklaagtdyaffcsfpghism
mkgtvtvk

SCOP Domain Coordinates for d1joi__:

Click to download the PDB-style file with coordinates for d1joi__.
(The format of our PDB-style files is described here.)

Timeline for d1joi__: