SCOPe 2.08: Domain d4lqta1: 4lqt A:2-232

Lineage for d4lqta1 (4lqt A:2-232)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein Green fluorescent protein, GFP [54513] (6 species)

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (285 PDB entries)
   Uniprot P42212

8. Domain d4lqta1: 4lqt A:2-232 [229865]
   Other proteins in same PDB: d4lqta2
   automated match to d3st2a_
   complexed with edo; mutant

Details for d4lqta1

PDB Entry: 4lqt, 1.1 Å

PDB Description: 1.10a resolution crystal structure of a superfolder green fluorescent protein (w57a) mutant

PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d4lqta1:

Sequence; same for both SEQRES and ATOM records:

>d4lqta1 d.22.1.1 (A:2-232) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilveldgdvnghkfsvrgegegdatngkltlkficttgklpvpaptlv
ttlgygvqcfsrypdhmkqhdffksampegyvqertisfkddgtyktraevkfegdtlvn
rielkgidfkedgnilghkleynfnshnvyitadkqkngikanfkirhnvedgsvqladh
yqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagithg

Timeline for d4lqta1:

• d4lqta1 first appeared in SCOPe 2.03, called d4lqta_
  
• d4lqta1 appears in SCOPe 2.07