![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
![]() | Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
![]() | Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
![]() | Protein Green fluorescent protein, GFP [54513] (6 species) |
![]() | Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (285 PDB entries) Uniprot P42212 |
![]() | Domain d4lqta1: 4lqt A:2-232 [229865] Other proteins in same PDB: d4lqta2 automated match to d3st2a_ complexed with edo; mutant |
PDB Entry: 4lqt (more details), 1.1 Å
SCOPe Domain Sequences for d4lqta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lqta1 d.22.1.1 (A:2-232) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]} skgeelftgvvpilveldgdvnghkfsvrgegegdatngkltlkficttgklpvpaptlv ttlgygvqcfsrypdhmkqhdffksampegyvqertisfkddgtyktraevkfegdtlvn rielkgidfkedgnilghkleynfnshnvyitadkqkngikanfkirhnvedgsvqladh yqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagithg
Timeline for d4lqta1: