SCOPe 2.03: Domain d4lqta_: 4lqt A:

Lineage for d4lqta_ (4lqt A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (14 species)
   not a true protein

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (40 PDB entries)

8. Domain d4lqta_: 4lqt A: [229865]
   automated match to d3st2a_
   complexed with edo; mutant

Details for d4lqta_

PDB Entry: 4lqt, 1.1 Å

PDB Description: 1.10a resolution crystal structure of a superfolder green fluorescent protein (w57a) mutant

PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d4lqta_:

Sequence; same for both SEQRES and ATOM records:

>d4lqta_ d.22.1.1 (A:) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
askgeelftgvvpilveldgdvnghkfsvrgegegdatngkltlkficttgklpvpaptl
vttlgygvqcfsrypdhmkqhdffksampegyvqertisfkddgtyktraevkfegdtlv
nrielkgidfkedgnilghkleynfnshnvyitadkqkngikanfkirhnvedgsvqlad
hyqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagithg

Timeline for d4lqta_:

• d4lqta_ is new in SCOPe 2.03-stable
  
• d4lqta_ appears in SCOPe 2.04
  
• d4lqta_ appears in the current release, SCOPe 2.08, called d4lqta1