Lineage for d3znma_ (3znm A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2776025Protein automated matches [190291] (19 species)
    not a true protein
  7. 2776190Species Influenza virus [TaxId:644788] [193029] (6 PDB entries)
  8. 2776191Domain d3znma_: 3znm A: [229354]
    Other proteins in same PDB: d3znmb_, d3znmd_, d3znmf_
    automated match to d4bgxa_
    complexed with epe, nag

Details for d3znma_

PDB Entry: 3znm (more details), 2.4 Å

PDB Description: h5 haemagglutinin in complex with sialyl-lewis x
PDB Compounds: (A:) Haemagglutinin

SCOPe Domain Sequences for d3znma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3znma_ b.19.1.2 (A:) automated matches {Influenza virus [TaxId: 644788]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrnsp

SCOPe Domain Coordinates for d3znma_:

Click to download the PDB-style file with coordinates for d3znma_.
(The format of our PDB-style files is described here.)

Timeline for d3znma_: