Lineage for d4bgxa_ (4bgx A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.19: Viral protein domain [49817] (1 superfamily)
sandwich; 9 strands in 2 sheets; jelly-roll; form trimersSuperfamily b.19.1: Viral protein domain [49818] (4 families) 
forms homotrimersFamily b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) 
Protein automated matches [190291] (19 species)
not a true protein
Species Influenza virus [TaxId:644788] [193029] (6 PDB entries) 
Domain d4bgxa_: 4bgx A: [193035]
Other proteins in same PDB: d4bgxb_
automated match to d2fk0a1
complexed with epe, nag
Details for d4bgxa_
PDB Entry: 4bgx (more details), 2.48 Å
PDB Description: h5 (vn1194) influenza virus haemagglutinin in complex with human receptor analogue 6'-sln
PDB Compounds: (A:) HemagglutininSCOPe Domain Sequences for d4bgxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bgxa_ b.19.1.2 (A:) automated matches {Influenza virus [TaxId: 644788]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrnsp
SCOPe Domain Coordinates for d4bgxa_:
Click to download the PDB-style file with coordinates for d4bgxa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4bgxa_:
- d4bgxa_ first appeared in SCOPe 2.02
- d4bgxa_ appears in SCOPe 2.07
View in 3D
