PDB entry 4bgx

View 4bgx on RCSB PDB site
Description: H5 (VN1194) Influenza Virus Haemagglutinin in Complex with Human Receptor Analogue 6'-SLN
Class: viral protein
Keywords: viral protein, n-glycosylation, virus receptor, bird flu
Deposited on 2013-03-29, released 2013-04-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-05-22, with a file datestamp of 2013-05-17.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: 0.1948
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: INFLUENZA VIRUS [TaxId:644788]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4bgxa_
  • Chain 'B':
    Compound: Hemagglutinin
    Species: INFLUENZA VIRUS [TaxId:644788]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4bgxb_
  • Heterogens: NAG, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bgxA (A:)
    dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
    llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
    swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
    pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
    fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
    ecpkyvksnrlvlatglrnspqretr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bgxA (A:)
    dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
    llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
    swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
    pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
    fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
    ecpkyvksnrlvlatglrnsp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4bgxB (B:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseea
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bgxB (B:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqy