Lineage for d3znmf_ (3znm F:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3041482Protein automated matches [254646] (29 species)
    not a true protein
  7. 3041551Species Influenza A virus (a/vietnam/1194/2004(h5n1)) [TaxId:644788] [256161] (6 PDB entries)
  8. 3041554Domain d3znmf_: 3znm F: [239961]
    Other proteins in same PDB: d3znma_, d3znmc_, d3znme_
    automated match to d2fk0b1
    complexed with epe, nag

Details for d3znmf_

PDB Entry: 3znm (more details), 2.4 Å

PDB Description: h5 haemagglutinin in complex with sialyl-lewis x
PDB Compounds: (F:) Haemagglutinin

SCOPe Domain Sequences for d3znmf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3znmf_ h.3.1.1 (F:) automated matches {Influenza A virus (a/vietnam/1194/2004(h5n1)) [TaxId: 644788]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqys

SCOPe Domain Coordinates for d3znmf_:

Click to download the PDB-style file with coordinates for d3znmf_.
(The format of our PDB-style files is described here.)

Timeline for d3znmf_: