PDB entry 3znm

View 3znm on RCSB PDB site
Description: H5 Haemagglutinin in Complex with Sialyl-Lewis X
Class: viral protein
Keywords: viral protein, sialic acid, glycoprotein, virus receptor, sulfated sialoside, fucosylated sialoside, sulfation, fucosylation, avian flu, sialyllactosamine, 3sln, 3'sln, sulfated lewis x
Deposited on 2013-02-15, released 2013-09-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Haemagglutinin
    Species: INFLUENZA A VIRUS [TaxId:644788]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3znma_
  • Chain 'B':
    Compound: Haemagglutinin
    Species: INFLUENZA A VIRUS [TaxId:644788]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3znmb_
  • Chain 'C':
    Compound: Haemagglutinin
    Species: INFLUENZA A VIRUS [TaxId:644788]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3znmc_
  • Chain 'D':
    Compound: Haemagglutinin
    Species: INFLUENZA A VIRUS [TaxId:644788]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3znmd_
  • Chain 'E':
    Compound: Haemagglutinin
    Species: INFLUENZA A VIRUS [TaxId:644788]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3znme_
  • Chain 'F':
    Compound: Haemagglutinin
    Species: INFLUENZA A VIRUS [TaxId:644788]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3znmf_
  • Heterogens: NAG, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3znmA (A:)
    dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
    llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
    swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
    pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
    fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
    ecpkyvksnrlvlatglrnspqretr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3znmA (A:)
    dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
    llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
    swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
    pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
    fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
    ecpkyvksnrlvlatglrnsp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3znmB (B:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseea
    

    Sequence, based on observed residues (ATOM records): (download)
    >3znmB (B:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqys
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3znmC (C:)
    dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
    llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
    swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
    pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
    fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
    ecpkyvksnrlvlatglrnspqretr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3znmC (C:)
    dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
    llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
    swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
    pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
    fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
    ecpkyvksnrlvlatglrnsp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3znmD (D:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseea
    

    Sequence, based on observed residues (ATOM records): (download)
    >3znmD (D:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqys
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3znmE (E:)
    dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
    llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
    swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
    pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
    fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
    ecpkyvksnrlvlatglrnspqretr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3znmE (E:)
    dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
    llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
    swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
    pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
    fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
    ecpkyvksnrlvlatglrnsp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3znmF (F:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseea
    

    Sequence, based on observed residues (ATOM records): (download)
    >3znmF (F:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqys