![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
![]() | Protein automated matches [190291] (19 species) not a true protein |
![]() | Species Influenza virus [TaxId:644788] [193029] (6 PDB entries) |
![]() | Domain d3znmc_: 3znm C: [229361] Other proteins in same PDB: d3znmb_, d3znmd_, d3znmf_ automated match to d4bgxa_ complexed with epe, nag |
PDB Entry: 3znm (more details), 2.4 Å
SCOPe Domain Sequences for d3znmc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3znmc_ b.19.1.2 (C:) automated matches {Influenza virus [TaxId: 644788]} dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig ecpkyvksnrlvlatglrnsp
Timeline for d3znmc_: