SCOPe 2.07: Domain d4ilwf_: 4ilw F:

Lineage for d4ilwf_ (4ilw F:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein automated matches [190182] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186920] (33 PDB entries)

8. Domain d4ilwf_: 4ilw F: [228947]
   Other proteins in same PDB: d4ilwa_, d4ilwb_
   automated match to d3v96b_
   complexed with ca, zn

Details for d4ilwf_

PDB Entry: 4ilw, 2.1 Å

PDB Description: Complex of matrix metalloproteinase-10 catalytic domain (MMP-10cd) with tissue inhibitor of metalloproteinases-2 (TIMP-2)

PDB Compounds: (F:) Stromelysin-2

SCOPe Domain Sequences for d4ilwf_:

Sequence; same for both SEQRES and ATOM records:

>d4ilwf_ d.92.1.11 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpkwrkthltyrivnytpdlprdavdsaiekalkvweevtpltfsrlyegeadimisfav
kehgdfysfdgpghslahayppgpglygdihfdddekwtedasgtnlflvaahelghslg
lfhsantealmyplynsftelaqfrlsqddvngiqslyg

Timeline for d4ilwf_:

• d4ilwf_ first appeared in SCOPe 2.03
  
• d4ilwf_ appears in SCOPe 2.06
  
• d4ilwf_ appears in the current release, SCOPe 2.08