Lineage for d4ilwf_ (4ilw F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964231Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2964641Protein automated matches [190182] (1 species)
    not a true protein
  7. 2964642Species Human (Homo sapiens) [TaxId:9606] [186920] (33 PDB entries)
  8. 2964678Domain d4ilwf_: 4ilw F: [228947]
    Other proteins in same PDB: d4ilwa_, d4ilwb_
    automated match to d3v96b_
    complexed with ca, zn

Details for d4ilwf_

PDB Entry: 4ilw (more details), 2.1 Å

PDB Description: Complex of matrix metalloproteinase-10 catalytic domain (MMP-10cd) with tissue inhibitor of metalloproteinases-2 (TIMP-2)
PDB Compounds: (F:) Stromelysin-2

SCOPe Domain Sequences for d4ilwf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ilwf_ d.92.1.11 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpkwrkthltyrivnytpdlprdavdsaiekalkvweevtpltfsrlyegeadimisfav
kehgdfysfdgpghslahayppgpglygdihfdddekwtedasgtnlflvaahelghslg
lfhsantealmyplynsftelaqfrlsqddvngiqslyg

SCOPe Domain Coordinates for d4ilwf_:

Click to download the PDB-style file with coordinates for d4ilwf_.
(The format of our PDB-style files is described here.)

Timeline for d4ilwf_: