![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) |
![]() | Protein automated matches [190182] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186920] (33 PDB entries) |
![]() | Domain d4ilwf_: 4ilw F: [228947] Other proteins in same PDB: d4ilwa_, d4ilwb_ automated match to d3v96b_ complexed with ca, zn |
PDB Entry: 4ilw (more details), 2.1 Å
SCOPe Domain Sequences for d4ilwf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ilwf_ d.92.1.11 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mpkwrkthltyrivnytpdlprdavdsaiekalkvweevtpltfsrlyegeadimisfav kehgdfysfdgpghslahayppgpglygdihfdddekwtedasgtnlflvaahelghslg lfhsantealmyplynsftelaqfrlsqddvngiqslyg
Timeline for d4ilwf_: