SCOPe 2.07: Domain d4ilwb_: 4ilw B:

Lineage for d4ilwb_ (4ilw B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.3: TIMP-like [50242] (4 families)

5. Family b.40.3.1: Tissue inhibitor of metalloproteinases, TIMP [50243] (2 proteins)
   contains an irregular alpha+beta subdomain in the C-terminal extension
   automatically mapped to Pfam PF00965

6. Protein TIMP-2 [50246] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50247] (4 PDB entries)

8. Domain d4ilwb_: 4ilw B: [228944]
   Other proteins in same PDB: d4ilwd_, d4ilwf_
   automated match to d1br9a_
   complexed with ca, zn

Details for d4ilwb_

PDB Entry: 4ilw, 2.1 Å

PDB Description: Complex of matrix metalloproteinase-10 catalytic domain (MMP-10cd) with tissue inhibitor of metalloproteinases-2 (TIMP-2)

PDB Compounds: (B:) metalloproteinase inhibitor 2

SCOPe Domain Sequences for d4ilwb_:

Sequence; same for both SEQRES and ATOM records:

>d4ilwb_ b.40.3.1 (B:) TIMP-2 {Human (Homo sapiens) [TaxId: 9606]}
cscspvhpqqafcnadvvirakavsekevdsgndiygnpikriqyeikqikmfkgpekdi
efiytapssavcgvsldvggkkeyliagkaegdgkmhitlcdfivpwdtlsttqkkslnh
ryqmgceckitrcpmipcyisspdeclwmdwvtekninghqakffacikrsdgscawyrg
aa

Timeline for d4ilwb_:

• d4ilwb_ first appeared in SCOPe 2.03
  
• d4ilwb_ appears in SCOPe 2.06
  
• d4ilwb_ appears in the current release, SCOPe 2.08