Lineage for d2b3ia_ (2b3i A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10904Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 10905Superfamily b.6.1: Cupredoxins [49503] (3 families) (S)
  5. 10906Family b.6.1.1: Plastocyanin/azurin-like [49504] (7 proteins)
  6. 11048Protein Plastocyanin [49507] (14 species)
  7. 11075Species Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId:1223] [49521] (2 PDB entries)
  8. 11076Domain d2b3ia_: 2b3i A: [22876]

Details for d2b3ia_

PDB Entry: 2b3i (more details)

PDB Description: nmr solution structure of plastocyanin from the photosynthetic prokaryote, prochlorothrix hollandica (19 structures)

SCOP Domain Sequences for d2b3ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b3ia_ b.6.1.1 (A:) Plastocyanin {Photosynthetic prokaryote (Prochlorothrix hollandica)}
asvqikmgtdkyaplyepkalsisagdtvefvmnkvgphnvifdkvpagesapalsntkl
aiapgsfysvtlgtpgtysfyctphrgagmvgtitve

SCOP Domain Coordinates for d2b3ia_:

Click to download the PDB-style file with coordinates for d2b3ia_.
(The format of our PDB-style files is described here.)

Timeline for d2b3ia_: