PDB entry 2b3i

View 2b3i on RCSB PDB site
Description: nmr solution structure of plastocyanin from the photosynthetic prokaryote, prochlorothrix hollandica (19 structures)
Deposited on 1998-12-11, released 1999-04-27
The last revision prior to the SCOP 1.55 freeze date was dated 2000-05-19, with a file datestamp of 2000-05-19.
Experiment type: NMR19
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d2b3ia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b3iA (A:)
    asvqikmgtdkyaplyepkalsisagdtvefvmnkvgphnvifdkvpagesapalsntkl
    aiapgsfysvtlgtpgtysfyctphrgagmvgtitve