Lineage for d7pcya_ (7pcy A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1527467Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1527468Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1527469Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 1527836Protein Plastocyanin [49507] (16 species)
  7. 1527853Species Green alga (Enteromorpha prolifera) [TaxId:3117] [49515] (1 PDB entry)
  8. 1527854Domain d7pcya_: 7pcy A: [22863]
    complexed with cu

Details for d7pcya_

PDB Entry: 7pcy (more details), 1.8 Å

PDB Description: the crystal structure of plastocyanin from a green alga, enteromorpha prolifera
PDB Compounds: (A:) plastocyanin

SCOPe Domain Sequences for d7pcya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7pcya_ b.6.1.1 (A:) Plastocyanin {Green alga (Enteromorpha prolifera) [TaxId: 3117]}
aaivklggddgslafvpnnitvgagesiefinnagfphnivfdedavpagvdadaisaed
ylnskgqtvvrklttpgtygvycdphsgagmkmtitvq

SCOPe Domain Coordinates for d7pcya_:

Click to download the PDB-style file with coordinates for d7pcya_.
(The format of our PDB-style files is described here.)

Timeline for d7pcya_: