Lineage for d7pcy__ (7pcy -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10904Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 10905Superfamily b.6.1: Cupredoxins [49503] (3 families) (S)
  5. 10906Family b.6.1.1: Plastocyanin/azurin-like [49504] (7 proteins)
  6. 11048Protein Plastocyanin [49507] (14 species)
  7. 11070Species Green alga (Enteromorpha prolifera) [TaxId:3117] [49515] (1 PDB entry)
  8. 11071Domain d7pcy__: 7pcy - [22863]

Details for d7pcy__

PDB Entry: 7pcy (more details), 1.8 Å

PDB Description: the crystal structure of plastocyanin from a green alga, enteromorpha prolifera

SCOP Domain Sequences for d7pcy__:

Sequence; same for both SEQRES and ATOM records: (download)

>d7pcy__ b.6.1.1 (-) Plastocyanin {Green alga (Enteromorpha prolifera)}
aaivklggddgslafvpnnitvgagesiefinnagfphnivfdedavpagvdadaisaed
ylnskgqtvvrklttpgtygvycdphsgagmkmtitvq

SCOP Domain Coordinates for d7pcy__:

Click to download the PDB-style file with coordinates for d7pcy__.
(The format of our PDB-style files is described here.)

Timeline for d7pcy__: