SCOPe 2.08: Domain d7pcya_: 7pcy A:

Lineage for d7pcya_ (7pcy A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Plastocyanin [49507] (17 species)

7. Species Green alga (Enteromorpha prolifera) [TaxId:3117] [49515] (1 PDB entry)

8. Domain d7pcya_: 7pcy A: [22863]
   complexed with cu

Details for d7pcya_

PDB Entry: 7pcy, 1.8 Å

PDB Description: the crystal structure of plastocyanin from a green alga, enteromorpha prolifera

PDB Compounds: (A:) plastocyanin

SCOPe Domain Sequences for d7pcya_:

Sequence; same for both SEQRES and ATOM records:

>d7pcya_ b.6.1.1 (A:) Plastocyanin {Green alga (Enteromorpha prolifera) [TaxId: 3117]}
aaivklggddgslafvpnnitvgagesiefinnagfphnivfdedavpagvdadaisaed
ylnskgqtvvrklttpgtygvycdphsgagmkmtitvq

Timeline for d7pcya_:

• d7pcya_ first appeared (with stable ids) in SCOP 1.55, called d7pcy__
  
• d7pcya_ appears in SCOPe 2.07