SCOP 1.59: Domain d1d2ob1: 1d2o B:535-624

Lineage for d1d2ob1 (1d2o B:535-624)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.3: Prealbumin-like [49451] (6 superfamilies)

4. Superfamily b.3.5: B repeat unit of collagen binding surface protein (cna) [49478] (1 family)

5. Family b.3.5.1: B repeat unit of collagen binding surface protein (cna) [49479] (1 protein)

6. Protein B repeat unit of collagen binding surface protein (cna) [49480] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [49481] (2 PDB entries)

8. Domain d1d2ob1: 1d2o B:535-624 [22627]

Details for d1d2ob1

PDB Entry: 1d2o, 2 Å

PDB Description: crystal structure of a single b repeat unit (b1) of collagen binding surface protein (cna) of staphylococcus aureus.

SCOP Domain Sequences for d1d2ob1:

Sequence; same for both SEQRES and ATOM records:

>d1d2ob1 b.3.5.1 (B:535-624) B repeat unit of collagen binding surface protein (cna) {Staphylococcus aureus}
ettssigekvwddkdnqdgkrpekvsvnllangekvktldvtsetnwkyefkdlpkydeg
kkieytvtedhvkdyttdingttitnkytp

Timeline for d1d2ob1:

• d1d2ob1 first appeared (with stable ids) in SCOP 1.55
  
• d1d2ob1 appears in SCOP 1.57
  
• d1d2ob1 appears in SCOP 1.61
  
• d1d2ob1 appears in the current release, SCOPe 2.08