Lineage for d1d2ob2 (1d2o B:625-721)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 106204Fold b.3: Prealbumin-like [49451] (6 superfamilies)
  4. 106391Superfamily b.3.5: B repeat unit of collagen binding surface protein (cna) [49478] (1 family) (S)
  5. 106392Family b.3.5.1: B repeat unit of collagen binding surface protein (cna) [49479] (1 protein)
  6. 106393Protein B repeat unit of collagen binding surface protein (cna) [49480] (1 species)
  7. 106394Species Staphylococcus aureus [TaxId:1280] [49481] (2 PDB entries)
  8. 106398Domain d1d2ob2: 1d2o B:625-721 [22628]

Details for d1d2ob2

PDB Entry: 1d2o (more details), 2 Å

PDB Description: crystal structure of a single b repeat unit (b1) of collagen binding surface protein (cna) of staphylococcus aureus.

SCOP Domain Sequences for d1d2ob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d2ob2 b.3.5.1 (B:625-721) B repeat unit of collagen binding surface protein (cna) {Staphylococcus aureus}
getsatvtknwddnnnqdgkrpteikvelyqdgkatgktailnesnnwthtwtgldekak
gqqvkytveeltkvkgytthvdnndmgnlittnkytp

SCOP Domain Coordinates for d1d2ob2:

Click to download the PDB-style file with coordinates for d1d2ob2.
(The format of our PDB-style files is described here.)

Timeline for d1d2ob2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d2ob1