PDB entry 1d2o

View 1d2o on RCSB PDB site
Description: crystal structure of a single b repeat unit (b1) of collagen binding surface protein (cna) of staphylococcus aureus.
Deposited on 1999-09-25, released 2000-09-27
The last revision prior to the SCOP 1.59 freeze date was dated 2000-09-27, with a file datestamp of 2000-09-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.212
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d2oA (A:)
    ettssigekvwddkdnqdgkrpekvsvnllangekvktldvtsetnwkyefkdlpkydeg
    kkieytvtedhvkdyttdingttitnkytpgetsatvtknwddnnnqdgkrpteikvely
    qdgkatgktailnesnnwthtwtgldekakgqqvkytveeltkvkgytthvdnndmgnli
    ttnkytp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d2oB (B:)
    ettssigekvwddkdnqdgkrpekvsvnllangekvktldvtsetnwkyefkdlpkydeg
    kkieytvtedhvkdyttdingttitnkytpgetsatvtknwddnnnqdgkrpteikvely
    qdgkatgktailnesnnwthtwtgldekakgqqvkytveeltkvkgytthvdnndmgnli
    ttnkytp