![]() | Class b: All beta proteins [48724] (110 folds) |
![]() | Fold b.3: Prealbumin-like [49451] (6 superfamilies) |
![]() | Superfamily b.3.5: B repeat unit of collagen binding surface protein (cna) [49478] (1 family) ![]() |
![]() | Family b.3.5.1: B repeat unit of collagen binding surface protein (cna) [49479] (1 protein) |
![]() | Protein B repeat unit of collagen binding surface protein (cna) [49480] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [49481] (2 PDB entries) |
![]() | Domain d1d2oa1: 1d2o A:535-624 [22625] |
PDB Entry: 1d2o (more details), 2 Å
SCOP Domain Sequences for d1d2oa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d2oa1 b.3.5.1 (A:535-624) B repeat unit of collagen binding surface protein (cna) {Staphylococcus aureus} ettssigekvwddkdnqdgkrpekvsvnllangekvktldvtsetnwkyefkdlpkydeg kkieytvtedhvkdyttdingttitnkytp
Timeline for d1d2oa1: