SCOP 1.63: Domain d1cdg_2: 1cdg 582-686

Lineage for d1cdg_2 (1cdg 582-686)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.3: Prealbumin-like [49451] (6 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.1: Starch-binding domain [49452] (1 family)

5. Family b.3.1.1: Starch-binding domain [49453] (3 proteins)

6. Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
   this domain is the last one in the protein chain

7. Species Bacillus circulans, different strains [TaxId:1397] [49455] (29 PDB entries)

8. Domain d1cdg_2: 1cdg 582-686 [22485]
   Other proteins in same PDB: d1cdg_1, d1cdg_3, d1cdg_4
   complexed with ca, mal

Details for d1cdg_2

PDB Entry: 1cdg, 2 Å

PDB Description: nucleotide sequence and x-ray structure of cyclodextrin glycosyltransferase from bacillus circulans strain 251 in a maltose- dependent crystal form

SCOP Domain Sequences for d1cdg_2:

Sequence; same for both SEQRES and ATOM records:

>d1cdg_2 b.3.1.1 (582-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains}
lsgdqvsvrfvvnnattalgqnvyltgsvselgnwdpakaigpmynqvvyqypnwyydvs
vpagktiefkflkkqgstvtweggsnhtftapssgtatinvnwqp

Timeline for d1cdg_2:

• d1cdg_2 first appeared (with stable ids) in SCOP 1.55
  
• d1cdg_2 appears in SCOP 1.61
  
• d1cdg_2 appears in SCOP 1.65
  
• d1cdg_2 appears in the current release, SCOPe 2.08, called d1cdga2