![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) ![]() |
![]() | Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (18 proteins) this domain follows the catalytic beta/alpha barrel domain |
![]() | Protein Cyclodextrin glycosyltransferase [51018] (5 species) contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like |
![]() | Species Bacillus circulans, different strains [TaxId:1397] [51019] (29 PDB entries) |
![]() | Domain d1cdg_3: 1cdg 407-495 [27723] Other proteins in same PDB: d1cdg_1, d1cdg_2, d1cdg_4 complexed with ca, mal |
PDB Entry: 1cdg (more details), 2 Å
SCOP Domain Sequences for d1cdg_3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cdg_3 b.71.1.1 (407-495) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains} gstqerwinndvliyerkfgsnvavvavnrnlnapasisglvtslpqgsyndvlggllng ntlsvgsggaasnftlaaggtavwqytaa
Timeline for d1cdg_3: