Lineage for d1cdg_2 (1cdg 582-686)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10499Fold b.3: Prealbumin-like [49451] (6 superfamilies)
  4. 10500Superfamily b.3.1: Starch-binding domain [49452] (1 family) (S)
  5. 10501Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
  6. 10511Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
  7. 10512Species Bacillus circulans, different strains [TaxId:1397] [49455] (27 PDB entries)
  8. 10515Domain d1cdg_2: 1cdg 582-686 [22485]
    Other proteins in same PDB: d1cdg_1, d1cdg_3, d1cdg_4

Details for d1cdg_2

PDB Entry: 1cdg (more details), 2 Å

PDB Description: nucleotide sequence and x-ray structure of cyclodextrin glycosyltransferase from bacillus circulans strain 251 in a maltose-dependent crystal form

SCOP Domain Sequences for d1cdg_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cdg_2 b.3.1.1 (582-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains}
lsgdqvsvrfvvnnattalgqnvyltgsvselgnwdpakaigpmynqvvyqypnwyydvs
vpagktiefkflkkqgstvtweggsnhtftapssgtatinvnwqp

SCOP Domain Coordinates for d1cdg_2:

Click to download the PDB-style file with coordinates for d1cdg_2.
(The format of our PDB-style files is described here.)

Timeline for d1cdg_2: